PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00087586001
Common NameGSBRNA2T00087586001, LOC106354496
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family TALE
Protein Properties Length: 517aa    MW: 58953 Da    PI: 6.8065
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00087586001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.94.6e-103573941954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  GSBRNA2T00087586001 357 FEHflHPYPKESEKIMLAKQTGLSKNQVANWFINARVR 394
                          665559******************************88 PP

2BELL125.71.8e-40220291172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          erqelq+kk+kLl++ +eVdkrY+qy++q+++v+ssFe+vag+g+akpYts+Al++iSrhFrcL+dai+eqi
  GSBRNA2T00087586001 220 ERQELQSKKNKLLTMADEVDKRYNQYYHQMEAVASSFEMVAGHGAAKPYTSVALNRISRHFRCLRDAIKEQI 291
                          79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005747.6E-53149289IPR006563POX domain
PfamPF075266.5E-49155287IPR006563POX domain
PROSITE profilePS5007112.503335398IPR001356Homeobox domain
CDDcd000861.55E-11338399No hitNo description
SMARTSM003896.5E-10338402IPR001356Homeobox domain
SuperFamilySSF466897.7E-18339406IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-28341404IPR009057Homeodomain-like
PfamPF059206.4E-18355394IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 517 aa     Download sequence    Send to blast
MAVYYPTSVG MQPLYQESIY LNEQQQQQQA SSSSAASFSG GGGGLDIPNS DGGVRHEMVF  60
IPPTNDVVVT GLNESSSNDL SFQGGGLSLS LGNQIQYHYQ NLSNQLNYSN DENGKSLSHH  120
HHQHQAEQLP STGYSNGVGY YNNYRYETSG FVSSVLRSRY LKPTQQLLDE VVSVRKDMKL  180
GESNKKTKNN NNDKGQDFTN GPNNNNTENE KFPEELSPQE RQELQSKKNK LLTMADEVDK  240
RYNQYYHQME AVASSFEMVA GHGAAKPYTS VALNRISRHF RCLRDAIKEQ IQVIRGKLGE  300
KETSEEQGER IPRLRYLDQR LRQQRALHQQ LGMVRPSWRP QRGLPENSVS ILRAWLFEHF  360
LHPYPKESEK IMLAKQTGLS KNQVANWFIN ARVRLWKPMI EEMYKEEFGD ASELLSNSNR  420
DKNKMQETSQ LKHEDSYSSQ QHHQGNNNNN IAYTSAVEEN LVFTDPKPDR VTTTGDYDSL  480
MNYQGFGVDD YNRYIGLGNQ QDGRFSNPHQ LHDFVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B4e-16344402563Homeobox protein Meis2
3k2a_A4e-16344402563Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.66400.0seed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894930.0AC189493.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB084P16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013649900.10.0PREDICTED: BEL1-like homeodomain protein 3
SwissprotQ9FWS90.0BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLA0A078IDU90.0A0A078IDU9_BRANA; BnaAnng09220D protein
STRINGBra015845.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.20.0BEL1-like homeodomain 3
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]